<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5299 CA24378 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NVP 52
2 ABC+APV+D4T 87
3 3TC+ABC+ADV+D4T 22
4 3TC+APV+DLV 37

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I50V L33F, Q58E, L89V I13V, I15V, L19I, E35D, N37S, R41K, L63P, A71T, I72V, V82I, I93L  
>CA24378| codons 1-98
PQITLWQRPLVTVKVGGQIKEALLDTGADDTVFEDMSLPGKWKPKMIGGVGGFIKVREYD
QIPIEICGHKTVGTVLVGPTPINIIGRNVLTQLGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E Y188L   S68G, D123E, I142V, S162N, T200A, R211NS, L228LH, E248D, A272P, K281R, L283I, I293V, E297A, G333E, R356K, A371V, A376T, T386A, K390R, A400T, K454R, V466A, V467VI, T497S, A554S  
>CA24377| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNGTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKQNPDIVI
YQYVDDLLVGSDLEIGQHRAKIEELRQHLLSWGFFTPDEKHQKEPPFHWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLIRGTKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQEQGQWTYQIYQEPFKNLKTGKYAKMRGA
HTNDVKQLTEVVQKITTESIVIWGKAPKFRLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGRAGYVTDRGRQKAISLTDTTNQKTELQ
AIHLALQDSGLEVNIVSDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005