<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4743 CA24343 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC 78
2 3TC+D4T+IDV 126
3 3TC+D4T+IDV+RTV 26
4 3TC+D4T+NFV 35

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, K70R, M184V, T215F D67G     T7TA, K20R, T39TA, S68G, I135T, S162Y, Q174QH, I178M, Q207E, L228LHQ, A272P, A288S, E297K  
>CA24343| codons 1-299
PISPIEAVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKGGDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKHNPDMVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGFFTPDKKHQKEPPFQWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKSLTEVIPLTKEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A, L90M K43T L10I, L19I, N37NS, K55R, L63P, H69Q, A71V  
>CA24344| codons 1-98
PQITLWQRPIVTIKIGGQIKEALLDTGADDTILEEMSLPGRWTPKIIGGIGGFIRVRQYD
QIPIEICGQKVIGTVLVGPTPANIIGRNLMTQIGCTLN

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005