<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5735 CA24332 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 30
2 D4T 52
3 AZT+3TC 13
4 AZT+3TC+IDV 69
5 D4T+NFV+NVP 65
6 D4T+NVP+RTV 71
7 AZT+3TC+RTV+IDV 82

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, T215F   K101E, Y181V   T27S, E28K, K32E, V60I, T69N, R83K, V179I, T200A, Q207D, L228R, V245E, T286A, E297K  
>CA24332| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLSKEKIEALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSNRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
VQYMDDLYVGSDLEIGQHRAKIEELRDHLLRWGFFTPDKKHQKEPPFRWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M   E35D, M36I, R41K, R57K, L63P, A71V, I72V, I93L  
>CA24333| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVKQYD
QIPIEICGHKVVGTVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005