<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6405 CA24329 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+DDC 9
3 3TC+AZT 22
4 3TC+AZT+IDV 9
5 3TC+D4T+RTV 174
6 None 10
7 3TC+D4T+NFV 87

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10F, N88D I13V, I15V, N37T, R57K, L63P, I93L Q18Q*
>CA24329| codons 1-99
PQITLWQRPFVTVKVGG*LKEALLDTGADNTVLEEMTLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       K20R, V35IM, K43E, K104R, I135T, I202V, R211K, F214L, D250T, V317A, I329L, A360V, A400T, V466A, I506L  
>CA24328| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLWKWGLYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKTSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGAYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYARMRGV
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKAVSLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGILQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005