<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6796 CA24325 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 30
2 D4T 70
3 3TC+D4T+DDI+IDV 65
4 D4T+NFV+NVP 28
5 3TC+D4T+IDV 6
6 3TC+AZT+D4T+IDV 18
7 DDI+NFV+SQV 34
8 EFV+RTV+SQV 9
9 3TC+APV+D4T 9
10 3TC+APV+D4T+DDI 20
11 ABC+APV+RTV 9
12 3TC+DDI+IDV 21
13 3TC+D4T+DDI+LPV 33
14 APV+DDI+LPV 23

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54IM, L76LV, I84V, L90M V11VI, G73S, L89V L10I, I13V, I15IV, Q18QH, K20I, M36I, R41RK, I62V, L63P, A71V  
>CA24325| codons 1-98
PQITLWQRPIITVKVGGHLIEALLDTGADDTVLEEINLPGKWKPKIIGGIGGFMKVRQYD
QVPIEICGHKVISTVVVGPTPVNVIGRNVMTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, M184V, L210W, T215Y K219R   A98G T39D, E44D, V118I, K122E, I142V, S162C, V179I, G196E, I202V, R211K, L228H, V245VEKM, A272AP, K281R, I293V, E297R  
>CA24324| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICDELEKDGKISKIGPENPYNTPV
FAIKKKDSDKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIEQHRTKVEELRQHLWKWGFYTPDRKHQKEPPFHWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVVPLTREA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005