<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9866 CA24319 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 31
2 AZT+DDI 48
3 3TC+AZT 22
4 3TC+AZT+IDV 113
5 3TC+AZT+NFV 167

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   T12S, I62V, L63P, H69Q  
>CA24319| codons 1-99
PQITLWQRPLVSIKIGGQLKEALLDTGADNTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       V35L, R83K, D123E, I178L, D192N, R211K, A272P, K281R, T286A, E291D, I329V, R358K, A371V, E404D, T419I, D460N, A554S  
>CA24318| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYVDDLYVGSNLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTDVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGQGQWTYQIYQEPFKNLKTGKYARMKGA
HTNDVKQLTEVVQKIATESIVIWGKTPKFKLPIQKETWEAWWTDYWQATWIPEWEFVNIP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSSGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009