<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5173 CA24309 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 69
2 3TC+AZT+NFV 43
3 D4T+RTV+SQV 44
4 DDI+IDV+RTV 52
5 3TC+APV+EFV 26
6 3TC+ABC+APV 49

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46L, I54V, L90M L33I, N88D I13V, E35D, M36I, R57K, L63P, I93L  
>CA24309| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADNTVIEDINLPGRWKPKLIGGIGGFVKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74IV, M184V, L210W, T215Y       E6D, K43KE, V118I, Q174H, Q207E, R211K, L228H, A272P, E297A  
>CA24308| codons 1-300
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKHNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTAEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009