<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F L10I, M36I, R41K, L63T, H69K, L89M, I93L, L97I  
>R41002| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVFEEINLPGKWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTINF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D E6D, K11T, V35T, T39K, S68G, T69N, V111I, K122E, D123N, K166R, K173I, Q174K, D177E, T200A, Q207A, R211S, V245E  
>R41002| codons 1-253
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPV
FAIKKKDGNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRIKNPEIDI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWT

References
Author Title Citation
Kiertiburanakul, S Comparisons of primary HIV-1 drug resistance between recent and chronic HIV-1 infection within a sub-regional cohort of Asian patients. PLoS ONE, 2013