<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2204 CA24294 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 100
2 AZT+DDI+NFV 39
3 3TC+D4T+NVP 87
4 3TC+D4T+IDV 72
5 3TC+ABC+APV+D4T 37
6 APV+D4T+DDI+RTV 20

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   K103N   V35M, K43Q, V118I, E138Q, S162D, G196E, R211K, Q278H, T286A, I293V, E297K K13N, D86S
>CA24294| codons 1-302
PISPIETVPVKLNPGMDGPKVKQWPLTEEKIKALMEICTELEQEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQSFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNQTPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGAKALTEVVPLTKEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M N88D R41K, I62V, L63P, V77I, I93L  
>CA24295| codons 11-99
VTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVRQYDQVPIEICGHK
AIGTVLIGPTPVNVIGRDLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009