<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
R71TS144 R71TS144 Thailand 2009 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, E35N, M36I, R41K, L63S, H69K, I93L  
>R71TS144| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLENINLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V60I, K122E, D123N, K173M, Q174K, T200I, I202V, Q207A, R211S, V245E  
>R71TS144| codons 20-263
KVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNET
PGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRMKNPDIVIYQYMDDLYVGSDLEIGQHR
IKVEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVNDIQK
LVGK

References
Author Title Citation
Kiertiburanakul, S Comparisons of primary HIV-1 drug resistance between recent and chronic HIV-1 infection within a sub-regional cohort of Asian patients. PLoS ONE, 2013