<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9851 CA24261 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV 135
2 None 61
3 3TC+ABC+DLV+LPV 83

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A L10FI, L24LI, L33LF K20X, E35D, M36I, R41RK, R57K, L63P, A71V, I93L  
>CA24261| codons 1-99
PQITLWQRPFVTIKIGGQLXEALIDTGADDTVFEDINLPGKWKPKLIGGIGGFVKVKQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74I, M184V   K103KN, Y181C   K11KR, K20R, T39E, K166R, I202V, Q207E, R211K, A272P, K277R, T286A Y232YH, E302D
>CA24260| codons 1-302
PISPIETVPVRLKPGMDGPRVKQWPLTEEKIKALVEICEEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRTKVEELREHLLKWGFTTPDKKHQKEPPFLWMGHELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTEEAE
LD

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005