<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9849 CA24257 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 122
2 3TC+AZT+IDV 78
3 3TC+AZT+NFV 35
4 D4T+DDI+EFV 39
5 ABC+APV+EFV 65
6 ABC+EFV+NFV 23

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L33F, N88D N37NS, L63Q, A71V  
>CA24257| codons 1-98
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVFEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIQIEICGHKVIGTVLVGPTPVNIIGRDLLTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V D67G, K219E K101P, K103N   K20R, K64R, D123E, R172K, Q207E, R211K, F214L K11K*, T253TS
>CA24256| codons 1-298
PISPIETVPV*LKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIRKKGSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLPKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGLTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWSVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEE

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, V31I, M50T, L101I, K111N, T124N, I208L, D256E S283N
>CA125446| codons 1-288
FLDGIDKAQEDHEKYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEATHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVNTIHTDNGSN
FTSNTVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDLQTKELQKQITKIQNFRVYYRDSRDPLWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVANRQDED

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005