<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9848 CA24255 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 DDI 52
3 D4T 26
4 3TC+AZT 47
5 3TC+AZT+SQV 8
6 3TC+AZT+IDV 104
7 D4T+DDI+RTV+SQV 21
8 3TC+ABC+AZT+NFV+NVP 47
9 3TC+D4T+NFV+NVP 39
10 3TC+D4T+EFV+NFV 17
11 APV+D4T+DDI+LPV 55

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82A, I84V L33F L10I, R57K, D60E, I62V, L63P, A71V, I72T, I93L  
>CA24255| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKLIVGIGGFVKVKQYE
QVPIEICGHKVTGTVLVGPTPANVIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74I, L210W, T215F K219W Y181C, G190A V108I V35M, T39A, K43E, K101Q, K104N, V118I, D123E, K166R, R172K, D177E, I202V, R211A, L228H, D237N, V245E, A272P, K277R, V292VI, E297K  
>CA24254| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLQKKNSVTILDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFKKQNPEIVI
CQYMDDLYVASDLEIGQHRTKVEELRQHLWAWGFFTPDWKHQKEPPFHWMGYELHPNKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEIIPLTKEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005