<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7126 CA24237 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV 112
2 3TC+D4T+EFV 23

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   L10R, I15IV, K20I, E35D, M36X, N37S, R57K, I62V, L63P, I64V, I93L, C95F  
>CA24237| codons 1-99
PQITLWQRPRVTIKVGGQLIEALLDTGADDTVLEDXSLPGRWKPKIIGGIGGFIKVKQYD
QVPVEICGHKAIGTVLVGPTPVNIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, L210W, T215Y   L100LI, K103N K238KN K43N, S68G, I135T, T200A, E203K, Q207E, R211RK, I293V, E297K I270IM
>CA24236| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRAKIKELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDNWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQMYAGIKVKQLCKLLRGTKALTEVVPLTKEAE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005