<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4366 CA24206 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC 82
2 D4T+NFV+NVP 82
3 Unknown 128

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q K103S, G190A   V35T, T39TA, V60I, T69TN, K102Q, D123E, I135L, S162A, D177A, G196E, A272P, K277R, T286A, I293V, E297K  
>CA24206| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQSKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPAIVI
YQYVDDLYVASDLEIEQHRTKIEELRQHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVVPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63P, V77I  
>CA24207| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005