<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9829 CA24181 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC 104
2 D4T+IDV+NVP+RTV 73
3 3TC+D4T+NFV 121

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D K45KR, L63P, V77VI, I93L  
>CA24181| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMNLPGRWKPRMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74LV, M184MV, T215Y   K103KN, Y181YC   K20KR, V35X, R83RK, D177E, T200E, Q207E, R211K, L228LR, V292I, I293V  
>CA24180| codons 1-303
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALXEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
CQYVDDLYVGSDLEIGQHREKIEELREHLLKWGFYTPDKKHQKEPPFRWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEIVPLTEEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005