<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9824 CA24162 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 AZT+3TC 147
3 AZT+3TC+EFV 128

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, T215F D67T, K219E L100I, K103N   K20R, T69N, I142V, T200I, L228R, E248Q, K277R, V292I, I293V P157A
>CA24162| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKTSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSAAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRIKIEELRQHLLRWGFFTPDEKHQKEPPFRWMGYELHPDKWT
VQPIVLPQKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEIVPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37D, D60E, L63P, C67Y, I72V, V77I  
>CA24163| codons 1-98
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKMIGGIGGFIKVRQYE
QIPIEIYGHKAVGTVLIGPTPVNIIGRNLLTQIGCTLN

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005