<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4797 CA24148 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 61
2 None 57
3 3TC+IDV 22
4 3TC+AZT+IDV 244

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       K43Q, E44D, K122E, T200I, Q207A, R211K, V245M, E248D, D250E, R284K, I293V T286R
>CA24148| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELRAHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPDKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGRKALTEVVPLTEEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82F, L90M   L19Q, K20I, I64V, A71V, V77I, I85V, I93L  
>CA24149| codons 15-98
IGGQQIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFVKVRQYDQILVEICGHKVIGT
VLIGPTPFNIVGRNLMTQLGCTLN

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005