<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5976 CA24143 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 61
2 3TC+AZT+RTV+SQV 57
3 3TC+AZT+NFV 113
4 ABC+APV+D4T 31
5 Unknown 77

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, I84V, L90M   L10I, K20R, E35D, M36I, R41K, I62V, L63P, I64V, A71T, I93L  
>CA24143| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGKWKPKIIGGIGGFVKVRQYD
QVPVEICGHKTIGTVLVGPTPANVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, L210W, T215Y D67G     S68G, V118I, I142V, Q207E, R211K, D218E, K219T, I257L, K277R, T286A, I293V, E297K  
>CA24142| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKGGTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPETKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDLQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVVPLTKEAE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005