<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7075 CA24141 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 34
2 3TC+ABC+AZT+NFV 27

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   K14R, N37S, Q61E, L63P, A71AV, V77I, I93L  
>CA24141| codons 1-99
PQITLWQRPLVTIRIGGQLKEALLDTGADNTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
EIPIEICGHKVIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115YF, M184V N348I     M16MV, Q207E, R211K, V245E, A272P, I293V, T338S, K390R, T403I, Q428R, L452S, K512R, S519N  
>CA24140| codons 1-560
PISPIETVPVKLKPGVDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWSYQIYQEPFKILKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWEAWWIEYWQATWIPEWEFVNTP
PLVKLWYRLEKEPIVGAETFYVDGAANRETKSGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGLEVNIVTDSQYALGIIQAQPDRSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005