<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1159 CA24139 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 9
2 DDI 26
3 D4T 18
4 AZT+D4T+IDV 26
5 AZT+DDI+NVP+RTV+SQV 230

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46IV, V82T, I84V T74P L10Y, I15V, L19LI, K20M, K55N, D60E, L63P, H69R, K70T, L89M  
>CA24139| codons 1-99
PQITLWQRPYVTIKVGGQIMEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFINVRQYE
QIPIEICGRTAIGPVLVGPTPTNVIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R K219E Y181C   K20R, V35L, T69N, E79D, K102M, V179I, G196E, T200A, E203K, Q207E, D218DE, L228R, E248D, A272P, T286A, P294PS, E297K  
>CA24138| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSNRWRKLVDFRDLNKRTQDFWEVQLGIPHPAGLKMKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYMDDLYVGSDLEIEQHRAKIKELREHLLRWGFTTPEEKHQKEPPFRWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVISLTKEAE

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005