<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3945 CA24122 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 25
2 DDI 21
3 3TC+D4T 13
4 3TC+D4T+IDV 8
5 AZT+DDI+NFV 91
6 RTV+SQV 30
7 EFV+SQV 21
8 ABC+APV 43
9 None 34
10 3TC+AZT+IDV+NFV+RTV 30
11 D4T+LPV+TDF 9

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   Y188L   K43E, K101Q, V106I, V118I, K122KE, D123E, S162C, T200A, R211K, L228H, A272P, V292I, E297K  
>CA24122| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSITVLDVGDAYFSIPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLLVGSDLEIGQHRAKIEELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEIIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L10F K20R, E35D, M36I, N37E, R57K, I62V, L63P, A71V, I93L  
>CA24123| codons 1-99
PQITLWQRPFVTIKIGGQLREALLDTGADDTVLEDIELPGRWKPKMIGGIGGFVKVKQYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005