<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4772 CA24115 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 129
2 None 6
3 3TC+D4T+IDV 26
4 D4T+ 3TC+ IDV 162

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M T74TP L10I, I13V, Q18QH, K20KM, P39S, K55R, D60E, L63P, A71V, V77I, I85V, I93L  
>CA24115| codons 1-98
PQITLWQRPIVTVKIGGHLMEALLDTGADDTVLEEMNLSGRWKPKIIGGIGGFIRVRQYE
QIPIEICGHKVIGPVLIGPTPVNIVGRNLMTQLGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y       R83K, I135V, S162C, I202V, Q207E, A272P, K277R, V292I, E297A  
>CA24114| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEIIPLTAEA

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005