<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4517 CA24106 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 113
2 AZT+DDC 52
3 3TC+AZT 54
4 3TC+D4T+NVP+RTV 49
5 3TC+D4T+NVP+RTV+SQV 65
6 D4T+NVP+RTV+SQV 108

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, L210W, T215CY F77L, K219HN K101E, G190A V108VI V35I, E36ED, K43E, E44A, R83K, V118I, K122P, I178L, G196E, Q207E, A272P, K275R, K277R, K281KR, T286A, E297KR  
>CA24106| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIDICTELEEAGKISKIGPENPYNTPV
FAIKKKNSTKWRKLMDLRELNKKTQDFWEVQLGIPHPAGLEKKKSVTILDVGDAYFSIPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYMDDLYVASDLEIEQHRTKIEELREHLWRWGFYTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCRLLRGAKALTEVIPLTREAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, V82A, I84V, L90M   L10I, I62V, L63H, A71V, V77I, I93L  
>CA24107| codons 1-98
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIVGIGGFIKVRQYD
QVHIEICGHKVIGTVLIGPTPANVIGRNLMTQLGCTLN

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005