<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4401 CA24103 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 3TC+AZT 83
3 D4T+DDI+NFV 79
4 3TC+ABC+APV 93

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54M, L90M L33F, G73A L10I, I13V, K14KR, L63P, V77I  
>CA24103| codons 1-98
PQITLWQRPIVTVRIGGQLKEALLDTGADDTVFEEMNLPGRWKPKMIGGIGGFMKVRQYD
QIPIEICGHKAIATVLIGPTPVNIIGRNLMTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, T215Y       P4S, T39S, K43E, E53D, V60I, V90I, K102Q, S162Y, G196E, A272P, K277R, A288S, K311R, D324E, M357T, R358K, G359S, K366R, A400T, E432D, D460N, V467I, K476Q, L491S, S519N, K527KHNQ, K558R  
>CA24102| codons 1-560
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICSELEEEGKISKIGPDNPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKSLTEVIPLTEEAE
LELAENREILREPVHGVYYDPSKELIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTKSA
HTNDVRQLTEAVQKIATESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVISLTDTTNQQTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIQKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRRVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009