<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+D4T+EFV+NVP 26
2 3TC+D4T+EFV 26
3 AZT+DDI+LPV 156

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219KQ     V8I, V21I, V35T, T39N, V60I, V106I, K122E, K166R, F171FY, D177E, I178M, T200A, Q207E, F214L, V245K  
>2100| codons 1-257
PISPIETIPVKLKPGMDGPKIKQWPLTEEKIKALTEICNEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPYRKQNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76LV, V82A Q58E L10V, T12P, I13V, G16GE, K20R, M36I, R41K, Q61QR, I64V, P79PH  
>2100| codons 1-99
PQITLWQRPVVPVKIEGQLREALLDTGADDTVLEEINLPGKWKPKIIGGIGGFVKVREYD
RILVEICGHKAIGTVVVGHTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Van Zyl, GU Trends in genotypic HIV-1 antiretroviral resistance between 2006 and 2012 in South African patients receiving first- and second-line antiretroviral treatment regimens. PLoS ONE, 2013