<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6428 CA24095 U.S. 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NFV 93
2 D4T+DDI+LPV+NVP 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, L63M, H69K, L89M  
>CA24095| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIMIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V     V108VI K11T, V35T, K122E, D123N, A158AT, K173S, D177E, I202V, Q207A, R211K, V245T, E248D, K275R, E291ED, V292I, I293V, P294T  
>CA24094| codons 1-303
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPTIFQSSMTKILEPFRSQNPEIVI
YQYVDDLYVGSDLEIGQHRTKVEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPDKDSWTVNDIQKLVGKLNWASQIYAGIRVKQLCKLLRGTKALTDIVTLTEEAE
LEL

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001