<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
7 2733 South Africa 2012 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+D4T+EFV+NVP 26
2 AZT+DDI+LPV 26

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L   T12TI, I15V, L19I, M36I, N37D, R41K, D60E, Q61E, H69K, K70KR, L89M, I93L  
>2733| codons 1-99
PQITLWQRPLVIIKVGGQIKEALLDTGADDTVLEEIDLPGKWKPKLIGGIGGFIKVRQYE
EILIEICGKRAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, K70KR, M184V       V35T, E36A, T39E, K122E, D123S, E169EA, K173T, Q174K  
>2733| codons 1-188
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILAPFRTKNPDIVI
YQYVDDLY

References
Author Title Citation
Van Zyl, GU Trends in genotypic HIV-1 antiretroviral resistance between 2006 and 2012 in South African patients receiving first- and second-line antiretroviral treatment regimens. PLoS ONE, 2013