<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4164 CA24045 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 52
2 3TC+AZT+NFV 52
3 D4T+DDI+NVP+RTV 71

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN N88D I15V, E35D, M36I, N37D, I62V, L63P, I72IV, I93L  
>CA24045| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADNTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAVGTVLVGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y188C V179E R83K, K102R, V106I, S163T, K173N, Q174K, Q207E, R211K, V245T, E248ED, A272P, R284K, T286A, E291D, I293V, E297T  
>CA24044| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKRKKSITVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSTMTKILEPFRNKNPDIEI
YQYMDDLCVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGAKALTDVVPLTTEAE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009