<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4749 CA24016 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+IDV 144
2 D4T+DDI+EFV 24
3 D4T+DDI 112

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, Q151M, T215FV A62V, V75I, F77L, F116Y, K219Q K103N, Y181C, G190A   V35I, K122E, A158S, S162A, T165I, R211K, F214L, D218DE, L228H, P247PT, K249Q, A272P, T286A, V292I, I293V Q182H, V254VD
>CA24016| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FVIKKKNSTRWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPSIFQASMIKILEPFRKQNPDIVI
CHYMDDLYVASDLEIGQHRTKIEELRQHLLKWGLFTPEQKHQKEPPFHWMGYELHPDKWT
VQPIVLTEQDSWTDNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIVPLTEEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I62IV, I64V  
>CA24017| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVLVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005