<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9777 CA24007 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC 165
2 D4T+DDI+RTV+SQV 52
3 3TC+ABC+APV+DLV+EFV+IDV 52
4 3TC+ABC+APV+RTV 17
5 None 53

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, R57RK, D60E, I62V, L63P, C67E, V77I  
>CA24007| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYE
QVPIEIEGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        S162C, E169D, D177E, G196E, Q207E, R211K, V245E, A272P, E297T K126P
>CA24006| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRPYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTTEAE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005