<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4889 CA24005 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 95
2 AZT+DDI+DLV 49
3 3TC+AZT+DLV 116
4 None 37
5 D4T+EFV+NFV 68
6 3TC+AZT+DDI+NFV 44

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36L, R41RK, K45KR, L63P, A71AT, V77I, I93L I15IT, E35V
>CA24005| codons 13-99
IKTGGQLKEALLDTGADDTVLEVLNLPGKWKPRMIGGIGGFIKVRQYDQIPIEICGHKTI
GTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103N   K11R, K32R, V35M, I50V, V60I, R83K, I135LV, K173Q, G196E, Q207QR, R211G, A272P, K277R, E297K  
>CA24004| codons 1-303
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIRALMEICTEMEKEGKISKVGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRQQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRRHLLGWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTKEAE
LEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005