<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+AZT+D4T+EFV+NVP 26
2 3TC+D4T+EFV 26
3 AZT+DDI+LPV 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R V75I, T215I, K219Q K103N   V35T, T39E, W88C, K122E, I132L, K173A, D177E, I178L, G196E, T200A, K201R, E204K, Q207E, F214L, V245Q, E248D  
>865| codons 1-258
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLIDFRELNKRTQDFCEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTLPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPELVI
YQYMDDLYVGSDLEIEQHRARIEKLREHLLRWGLITPDQKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L10F T12P, I15V, G16E, L19P, K20T, M36I, L63T, H69K, I93L  
>865| codons 1-99
PQITLWQRPFVPIKVEGQPTEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYD
QITIEICGKKAIGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Van Zyl, GU Trends in genotypic HIV-1 antiretroviral resistance between 2006 and 2012 in South African patients receiving first- and second-line antiretroviral treatment regimens. PLoS ONE, 2013