<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9773 CA23997 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 65
2 D4T 44
3 3TC+D4T 48
4 3TC+AZT+IDV 231

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54IV, V82A   L19I, N37S, I64IV, A71AV  
>CA23997| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADDTVLEEMSLPGRWKPKLIGGIGGFVKVRQYD
QILVEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, M184V, T215Y A62V, V75T     I31IL, V90I, K102R, D123E, I142V, V179I, Q207N, T286A, I293V, E297K, I329L, A360T, A376T, T386I, A400V, D460N, V467I, L491S, S519N, A554T, I556V, V559I E300E_E
>CA23996| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALVEICTELEKEGKISKIGPENPYNTPV
FVIKKKNSTKWRKLTDFRELNKRTQDFWEIQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKIEELRNHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQGQWTYQIYQEPFKNLKTGKYARMRGT
HTNDVKQLTEAVQKITTESIVIWGKIPKFKLPIQKETWEVWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVISLTDTTNQKTELQ
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSTGVRKIL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009