<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70E, Q151M, M184V A62V, V75S, K219R K103N V108I, P225H, K238T K20R, K22R, V35T, E36A, T39E, S68SG, K122E, D123N, I135R, K173E, D177EG, I178IM, T200A, Q207A, F214L, L228I, V241VM, V245Q  
>3077| codons 1-260
PISPIETVPVKLKPGMDGPRVRQWPLTEEKIKALTAICEEMEKEGKISKIGPENPYNTPV
FVIKKKDGTEWRKLSDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DENFRKYTAFTIPSRNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFREQNPGMVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLRWGLTTPDRKHQKEHPFIWMGYELHPDTWT
MQPIQLPEKDSWTVNDIQKL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L19T, M36I, R41K, L63A, H69K, I93L  
>3077| codons 1-99
PQITLWQRPLVTIKIGGQTKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIAIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Van Zyl, GU Trends in genotypic HIV-1 antiretroviral resistance between 2006 and 2012 in South African patients receiving first- and second-line antiretroviral treatment regimens. PLoS ONE, 2013