<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4992 CA23918 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 122
2 DDC+SQV 30
3 3TC+D4T+NVP 117
4 None 90

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, M184V, T215F K219Q K103NS, V106A   K20R, V35T, K43KR, K64Y, D123E, D177E, G196E, T200A, H208HY, R211NS, L228H, Q242H, K277R, T286A, E297K P1PH
>CA23918| codons 1-300
HISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTEMEREGKISKIGPENPYNTPV
FAIYKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSATVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIEQHRAKIEELRQYLLNWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VHPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, L63P, V77I, I93L  
>CA23919| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005