<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9748 CA23916 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NVP 182
2 3TC+AZT+NVP 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219E Y181C A98G K64N, K102Q, I135V, Q207K, D218E, K277R, A288S, I293V, E297A  
>CA23916| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAINKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKQKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRTKIEELRKHLLRWGFTTPEEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKSLTEVVPLTAEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, E35D, L63P, I72V, V77I, I93L  
>CA23917| codons 1-99
PQITLWQRPLVAIKIGGQLKEALLDTGADDTVLEDMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005