<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1137 CA23915 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 None 31
3 DDC 135
4 D4T 22
5 D4T+DDI 17
6 3TC+D4T+SQV 26
7 3TC+AZT+IDV 26
8 3TC+AZT 22
9 3TC+AZT+RTV+SQV 32
10 3TC+AZT 81
11 None 7
12 ABC+APV+EFV+RTV 6
13 ABC+APV+DLV+RTV 3
14 ABC+APV+DLV 55

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L76V Q58E L10V, L63P, V82VI  
>CA23915| codons 1-98
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVREYD
QIPIEICGHKAIGTVVVGPTPINIIGRNLLTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, Y115F, T215Y   K103N, Y181C   T39A, V90I, K122E, S162A, I202IV, A272P, K277R, Q278H  
>CA23914| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEIQLGIPHPAGLKKNKSVTVLDVGDAFFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKVEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRHLCKLLRGTKALTEVIPLTEEAE

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005