<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9747 CA23912 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NVP 13
2 3TC+AZT+NVP 214

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V N348I Y181C V108I V179I, T200A, H221Y, V245T, D250E, T286A, P294T, I329V, Q334E, T377R, A400T, E432D, T497S, L533M, Q547K  
>CA23912| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVITLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEVQKQGEGQWTYQIYQEPFKILKTGKYARMRGA
HTNDVKQLTEAVQKIARESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AIHLALQDSGLEVNIVSDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYMAWVPAHK
GIGGNEKVDKLVSAGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37T, R41K, R57RK, I62IV, L63P  
>CA23913| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMTLPGKWKPKMIGGIGGFIKVKQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005