<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7881 CA23901 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 55
2 3TC+AZT+DLV+NFV 16
3 ABC+DDI+LPV 32

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M F53FL, Q58E, L89V L10I, I13V, K20M, L33L_L, M36I, I62V, L63P, A71V, Q92K  
>CA23901| codons 1-99
PQITLWQRPIVTVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKMIGGIGGLVKVREYD
QVPIEICGHKVIGTVLVGPTPANIIGRNVMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E K103N   V35T, T69N, D121DH, K122E, I142V, I167IV, D177DG, T200A, Q207K, R211A, R284K, I293V  
>CA23900| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRKQNPGIVI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLAWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGTKALTEVVPLTEEAE
LE

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005