<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9734 CA23873 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+3TC+NFV 108

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N L10F, N88D I15V, N37S, R41K, Q61N, V77I  
>CA23873| codons 1-99
PQITLWQRPFVTIKVGGQLKEALLDTGADNTVLEEMSLPGKWKPKMIGGIGGFIKVRQYD
NILIEICGHKAIGTVLIGPTPVNIIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35I, K122E, D123N, I135T, I142T, D177E, T200A, V245I, E248D, K281R, V292I, I293V, V317G, K395R, E399D, A400L, Y405H, V435M, L452I, V466I, V467I, H483Y, G490E, K527N  
>CA23872| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIILPDKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGTKALTEIVPLTEEAE
LELAENREILKEPVHGGYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQRETWDLWWTEHWQATWIPEWEFVNTP
PLVKLWYQLEKEPIMGAETFYVDGAANRETKIGKAGYVTDRGRQKIISLTDTTNQKTELQ
AIYLALQDSELEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLINKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009