<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1267 CA23867 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI NA
2 D4T+ 3TC 23
3 SQV+ D4T+ 3TC 25
4 SQV+ D4T+ ADV+ 3TC 54
5 D4T+ 3TC+ RTV+ SQV 75
6 ABC+ D4T+ DDI 115

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K14R, L19I, L63P  
>CA23867| codons 1-99
PQITLWQRPVVTVRIGGQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L210W, T215FY K219KQ     K20R, V35VL, T39TA, K43KN, V60I, K104N, V118VI, K122KE, I135T, I142IV, S162Y, I178IM, T200A, Q207E, A288AS, I293V  
>CA23866| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICAELENEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLWRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005