<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2255 CA23845 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+DDI 29
2 3TC+DDI+SQV 12
3 3TC+DDI+IDV 51
4 D4T+IDV+NVP 74
5 NFV+SQV 17
6 3TC+ABC+AZT+DDI+EFV 121

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M   K20I, I64V, T74S, V77I, I85V  
>CA23845| codons 1-99
PQITLWQRPLVTIKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QILVEICGHKAIGSVLIGPTPVNVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K65R, D67N, Y115F, Q151M, M184I V75I, F77L, F116Y, K219Q Y181C, G190A   I31L, T58N, S68G, T69TI, V90I, K101Q, D123E, K166R, D177E, T200I, I202V, R211K, H221Y, V245T, D250E, A272P, K277R, I293V  
>CA23844| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKLKALVEICTELEKEGKISKIGPENPYNNPV
FAIKRKNGIKWRKLIDLRELNKRTQDFWEIQLGIPHPAGLQKKKSVTVLDVGDAFYSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTRILEPFRKQNPEIVI
CQYIDDLYVASDLEIGQHRIKVEELRQHLLKWGFTTPDQKYQKEPPFLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005