<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1529 CA23830 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 39
2 D4T 57
3 3TC+D4T 30
4 3TC+D4T+IDV 22
5 3TC+D4T+NFV 35
6 3TC+D4T+NVP 15
7 D4T+DDI+RTV+SQV 15
8 D4T+DDI 71
9 ABC+D4T+NVP 86

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69E_G, L210W, T215Y A62AV Y188L A98AG T39TA, E40X, K43KE, E44ED, V60I, S68SG, V75X, K101KQ, V106IL, V118I, D123E, I135V, S162C, G196E, T200A, E203DV, Q207DE, H208HY, R211RK, K238KR, T286A, I293V  
>CA23830| codons 1-302
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAXLEEDGKISKIGPENPYNTPI
FVIKKKNGEKWRKLXDFRELNKRTQDFWEVQLGIPHPGGLQKKKSITVLDVGDAYFSIPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVI
YQYMDDLLVGSDLEIEQHRAKIDELRDYLWKWGFYTPDKKHQKEPPFLWMGYELHPDRWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTEEAE
LE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37S, R57K, L63P, A71T, V77I  
>CA23831| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMSLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKTIGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005