<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I T12PS, G16GE, M36T, N37NT, P39S, R41RK, Q61E, L63P, I64V  
>TZ1| codons 1-99
PQITLWQRPLVSIKIEGQLKEALLDTGADDTVIEETTLSGKWKPKMIGGIGGFIKVRQYD
EIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E28K, K32E, V60I, K122E, I135T, D177E, T200A, Q207KN, R211AEKT, V245Q, A272AP, K275R, K277R, T286TA, E291D, V292I, I293V, P294T, V317VI, D324DE, I329L, Q334D, G335D, R356K, M357MV, A360AT, T377Q, S379C, K385KR, K390R, E404D, L452M, V458VI, R461K, S468C, L469M, H483N, L491PS  
>TZ1| codons 1-499
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIEALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRNHLLTWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGIYYDPSKELIAELQKQGDDQWTYQIYQEPFKNLKTGKYAKVRGT
HTNDVKQLTEAVQKIAQECIVIWGRTPKFRLPIQKETWEAWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKMGKAGYITDKGRQKVVCMTDTTNQKTELQ
AINLALQDSGSEVNIVTDS

References
Author Title Citation
Masimba, PJ Prevalence of drug-resistance mutations and HIV-1 subtypes in a HIV-1 infected cohort in rural Tanzania. ARHR, 2013