<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L       T39E, V60I, K122E, D123S, E138A, I142V, K173Q, T200I, Q207K, R211T  
>TZ107| codons 37-226
ICEELEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNATPGVRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRQQNPDIVIYQYMDDLYVGSDLEIGQHRIKIEELRKHLLTWGFTT
PDKKHQKEPP

References
Author Title Citation
Masimba, PJ Prevalence of drug-resistance mutations and HIV-1 subtypes in a HIV-1 infected cohort in rural Tanzania. ARHR, 2013