<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5472 CA23796 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 43
2 AZT+DDC 34
3 3TC+AZT+IDV 21
4 3TC+AZT+SQV 39
5 3TC+D4T+NVP 100
6 None 56
7 3TC+D4T+NFV 71

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L T215D Y181C   V35E, T39A, D123E, I135T, Q174QR, I178M, V179I, T200A, R211K, H221Y, A272P  
>CA23796| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALEEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDMII
CQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFDTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, K14R, E35D, M36I, R57RK, I62IV, L63P, I64V  
>CA23797| codons 1-99
PQITLWQRPLVPIRIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVKQYD
QVPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005