<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA9717 CA23794 U.S. 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 83
2 3TC+AZT 148
3 D4T+DDI+NVP 5
4 D4T+DDI+NFV 131

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F K219Q     K43KQ, T69N, K101Q, E169D, R211E, V245M, A272P, K277R, A288T, I293V, E297K  
>CA23794| codons 1-299
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEQEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLEWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKTLTEVVPLTKEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   K20R, E35ED, M36L, I62V, L63P, I64V, K70R, V75I, V77I  
>CA23795| codons 1-98
PQITLWQRPLVTIKIGGQLREALLDTGADNTVLEDLNLPGRWKPKMIGGIGGFIKVRQYD
QVPVEICGHRAIGTILIGPTPVNIIGRNLLTQIGCTLN

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005