<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None 26
2 RPV+FTC+TDF 48

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179E T39S, S48T, V60VI, K66N, S68G, V90VI, K102Q, K122E, D123S, A158S, I178L, V189VI, E203ED, R211K, I244V, V245E, A272P, R284K, A288S, V292I, I293V, E297A  
>STaR16_WK48| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICSEMEKEGKITKIGPENPYNTPI
FAIKKNDGTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLKQKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPDLEI
YQYMDDLYIGSDLEIGQHRTKIDELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPVELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLKGTKSLTEIVPLTAEAE
LELAENREILK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R57G, L63A, E65D, I72V, V77I  
>STaR16_WK48| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVGQYD
QIAIDICGHKAVGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Porter, DP Characterization of HIV-1 drug resistance development through week 48 in antiretroviral naive subjects on rilpivirine/emtricitabine/tenofovir DF or efavirenz/emtricitabine/tenofovir DF in the STaR study (GS-US-264-0110) JAIDS, 2014