<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 None 24
2 RPV+FTC+TDF 24

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   I13V, L19IT, K20T, E35G, M36I, R41K, R57G, I62V, L63T, I64V, I72T, T74S, V77I  
>STaR1_WK24| codons 1-99
PQITLWQRPLVTVKIGGQITEALLDTGADDTVLEGINLPGKWKPKMIGGIGGFIKVGQYD
QVTVEICGHKATGSVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K101KE, Y181I   V35IM, V90I, K122E, D123N, I135L, S162C, Q174K, V179I, G196E, A272P, A288T G45GEKR
>STaR1_WK24| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEEKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKKNPDIII
IQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKTLTEVIPLTEEAE
LELAENREILK

References
Author Title Citation
Porter, DP Characterization of HIV-1 drug resistance development through week 48 in antiretroviral naive subjects on rilpivirine/emtricitabine/tenofovir DF or efavirenz/emtricitabine/tenofovir DF in the STaR study (GS-US-264-0110) JAIDS, 2014